PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00013.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARF
Protein Properties Length: 745aa    MW: 83246.5 Da    PI: 6.6554
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00013.1_g00014.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.42.8e-23200300198
                              EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                              f kvlt sd++++g +++ +k+a+e+     + +++ ++ l+ +d +g +W +k+i+r++++r++lt+GW+ Fv++n+L +gD++v
  Sme2.5_00013.1_g00014.1 200 FYKVLTASDTSTHGGFSILRKHAKEClplldMTQPTPTQVLVAKDIHGFEWHFKHIFRGQPRRHLLTTGWSTFVSSNRLVAGDSFV 285
                              789***************************855556666888999***************************************** PP

                              EEE-SSSEE..EEEEE- CS
                       B3  82 Fkldgrsefelvvkvfr 98 
                              F   +++e+e +++++r
  Sme2.5_00013.1_g00014.1 286 FL--RSEEGEVRIGIRR 300
                              **..4589999999997 PP

2Auxin_resp102.84.2e-34326405183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              a+ha++t+++F v+Y+Pr+  s+F+v ++k+++a+++++svGmRfkm++e+e+ +err++Gt+vgv+d ++++W++SkWrsLk
  Sme2.5_00013.1_g00014.1 326 ASHAVATQTMFVVFYKPRK--SQFIVGLNKYLEAVNHRYSVGMRFKMHLEGEEIPERRFTGTIVGVED-SSSQWKDSKWRSLK 405
                              789***************6..9**********************************************.555*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.5E-37189329IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-37192315IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.562200302IPR003340B3 DNA binding domain
SMARTSM010195.8E-20200302IPR003340B3 DNA binding domain
PfamPF023622.4E-21200300IPR003340B3 DNA binding domain
CDDcd100171.54E-19200300No hitNo description
PfamPF065073.3E-32326405IPR010525Auxin response factor
PfamPF023092.8E-12621724IPR033389AUX/IAA domain
SuperFamilySSF542773.73E-11636716No hitNo description
PROSITE profilePS5174522.3640721IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MNCIKSYGDC VQVHQWMFQK EEKGFIISHK VTWNNGVINE GCGGVVNTHS YLTRGLVIVA  60
FVGEHFTGLF RLNPDLLVLM RVVLVFCLWS LILETRVFEN SLSISMSSET NKGCGEMLEA  120
STNPELNQII PLFNLQPKIL CHVLHIELNV ISCTFTVFLA EQDTDEVYAQ ITLLPEADQV  180
EPTSPDPSVP EPPRPKVHTF YKVLTASDTS THGGFSILRK HAKECLPLLD MTQPTPTQVL  240
VAKDIHGFEW HFKHIFRGQP RRHLLTTGWS TFVSSNRLVA GDSFVFLRSE EGEVRIGIRR  300
LACRPSSMPQ SVISSQSMHL GVLATASHAV ATQTMFVVFY KPRKSQFIVG LNKYLEAVNH  360
RYSVGMRFKM HLEGEEIPER RFTGTIVGVE DSSSQWKDSK WRSLKVQWDE PSSFSRPYRV  420
SPWDIEPFVA SVTTSLAQPI GVKNKRNRAH KEPKASEPVP PAGLAVWIPS PQFNLDIEGQ  480
SSDNPFSLHT SQSNTITTNG TFKARVDGIQ SASKVNASLN MLLDETEASK RASPRPAFPS  540
FASSQFGKQN DLLLPRLDDE RKCDTITSCR LFGIDLNCPS FSSANEKLPD GSAEGCSGKR  600
TSAVDSENNS GLSRDSEDQK QEQLNPPPKE VHNKQISSTR SCTKVQMQGV AVGRAVDLTI  660
LSGYDELIKE LKEMFEIQEE LHTRNKWEIV FTDDEGDVML MGDHPWPEFC NVAKRIFICS  720
SQDMKSFSAG TKSPSCFESE TTAST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-13611242846355Auxin response factor 1
4ldw_A1e-13611242846355Auxin response factor 1
4ldv_A1e-13611242846355Auxin response factor 1
4ldx_B1e-13611242846355Auxin response factor 1
4ldx_A1e-13611242846355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM5651270.0HM565127.1 Solanum lycopersicum auxin response factor 12 (ARF12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015083562.10.0PREDICTED: auxin response factor 18-like isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLK4CIX20.0K4CIX2_SOLLC; Auxin response factor
STRINGSolyc08g008380.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9